7EY4R

Local cryoem of the sars-cov-2 s6pv2 in complex with bd-667
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
183
structure length
183
Chain Sequence
NLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of SARS-CoV-2 B.1.351 neutralizing antibodies provide insights into cocktail design against concerning variants.
pubmed doi rcsb
molecule tags Viral protein
source organism Homo sapiens
molecule keywords BD-667 L
total genus 19
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2021-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF09408 bCoV_S1_RBD Betacoronavirus spike glycoprotein S1, receptor binding
R PF16451 bCoV_S1_N Betacoronavirus-like spike glycoprotein S1, N-terminal
R PF19209 CoV_S1_C Coronavirus spike glycoprotein S1, C-terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...