7EZNA

Crystal structure of cnyvh1 complex with vanadate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
191
structure length
175
Chain Sequence
GHMQEVVDGLWVGDLVAANDDDELEKNGIKNILSALRPSLKFSDKYAVYPLEIDDSADTDLLSHLPSCVAWIKEILDLRQKAARSPDIDTVAQPGKPGGVLVHCQAGMSRSASIVAAYLMSQYDLDPMEAMTMIREKRPVVEPSATFWHQLGLFYTTDGKVSLKDRSTRQYYMER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CnYvh1 complex with vanadate
rcsb
molecule keywords Protein-tyrosine-phosphatase
molecule tags Hydrolase
source organism Cryptococcus neoformans var. grubii serotype a (strain h99 / atcc 208821 / cbs 10515 / fgsc 9487)
total genus 64
structure length 175
sequence length 191
ec nomenclature ec 3.1.3.48: protein-tyrosine-phosphatase.
pdb deposition date 2021-06-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...