7F0SA

A crystal structure of alphavirus nonstructural protein 4 (nsp4) reveals an intrinsically 1dynamic rna-dependent rna polymerase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
490
structure length
419
Chain Sequence
VEDSLQNPEVAVAACNAFLEANYPXXXXXXXXXSAVPSPFANTLANVLAAATKRNCNVELPTLDSAVLNVECFKKFACNGEYWQEFKDNPIRITTENITTYVTRLKGPKAAALFAKTHNLVPLQEVPMDRFVVDMKKVQVIQAAEPLATAYLCGIHRELVRRLKAVLAPNIHTLFDMSAEDFDAIIAAHFQPGDAVLETDIASFDKSQDDSLALTALMLLEDLGVDQELLDLIEAAFGEITSVHLPTGTRFKFGAMMKSGMFLTLFVNTLLNIVIACRVLREKLTNSVCAAFIGDDNIVHGVRSDPLMAERCASWVNMEVKIIDATMCEKPPYFCGGFILYDKVTGSACRVADPLKRLFKLGKPLPAGDTQDEDRRRALKDETDRWARVGLKSELEIALSSRYTGNIVRAMAKNFKKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of alphavirus nonstructural protein 4 (nsP4) reveal an intrinsically dynamic RNA-dependent RNA polymerase fold.
pubmed doi rcsb
molecule tags Transferase
source organism Ross river virus (strain t48)
molecule keywords RNA-directed RNA polymerase nsP4
total genus 119
structure length 419
sequence length 490
ec nomenclature ec 2.7.7.19: polynucleotide adenylyltransferase.
pdb deposition date 2021-06-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...