7F1HA

Designed enzyme ra61 m48k/i72d mutant: form i
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
DTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGHFKAGKGWSTGGRRTVTYNASFNPSGDAYLTLYGWTRNPLVSYLIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTFQIFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATKGWQSSGSSTVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Engineered Retroaldolase
publication title Varying the Directionality of Protein Catalysts for Aldol and Retro-Aldol Reactions.
pubmed doi rcsb
source organism Synthetic construct
total genus 54
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2021-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...