7F2JA

Crystal structure of atfkbp53 fkbd in complex with rapamycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
SQVRTYPNGLIVEELSMGKPNGKRADPGKTVSVRYIGKLQKNGKIFDSNIGKSPFKFRLGIGSVIKGWDVGVNGMRVGDKRKLTIPPSMGYGVKGAGGQIPPNSWLTFDVELINVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal packing reveals rapamycin-mediated homodimerization of an FK506-binding domain.
pubmed doi rcsb
molecule tags Isomerase
source organism Arabidopsis thaliana
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP53
total genus 28
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2021-06-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...