7F3EA

Cryo-em structure of the minimal protein-only rnase p from aquifex aeolicus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
188
Chain Sequence
MDVFVLDTSVFTNPEIYRTFEERGAMETFIHLALNSRAEFYMPTSVYTEMRKIMDVGELWAEFEMVVKIRSPRRFQLTVPADFLYEFIEELRYRINKGLRIAEEHTREASGCEDVGKLIARLREKYREALRQGILDSKEDVDVLLLAYELDGVLVSADEGLRTWADKIGIKLIDPKNFKNILESLVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-free ribonuclease P
publication title Minimal protein-only RNase P structure reveals insights into tRNA precursor recognition and catalysis
rcsb
source organism Aquifex aeolicus (strain vf5)
total genus 52
structure length 188
sequence length 190
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2021-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08745 PIN_5 PINc domain ribonuclease
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...