7F3LA

Crystal structure of human ybx2 csd in complex with m5c rna in space group p62
Total Genus 15

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
75
Chain Sequence
KPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNKFLRSVGDGETVEFDVVEGEKGAEATNVTGPG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
source organism Homo sapiens
publication title Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P62
rcsb
molecule keywords Y-box-binding protein 2
total genus 15
structure length 75
sequence length 78
ec nomenclature
pdb deposition date 2021-06-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.