7F44A

Crystal structure of moraxella catarrhalis enoyl-acp-reductase (fabi) in complex with the cofactor nad
Total Genus 95

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
267
Chain Sequence
MLLKGQRFVVTGIASKLSIAWAIAESLHREGAQLILTYPNDKIKKRVDMAAEAFDAVAVIECDVGSDESIQVCFDEIAKHWGVGDDKGIDGIVHAIGFAPADQLDGDFTQATTREGSQIAHDISSYSFVALAKAGRELLAARQGSLLTLTYEGSISVLPNYNVMGMAKASLEASVRYLASSLGGEGIRVNAISAGPIRTLAASGIKSFRRMLDVSEKIAPLQRNVSQEEVGNAALFLLSPWASGITGEILFVDAGFNTVAISEKIMM

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TI1 (1-4)S1 (6-10)AH5 (114-142)TII1 (3-6)EMPTYS4 (91-94)TI2 (15-18)AH9 (227-238)AH1 (19-30)S2 (32-38)AH2 (43-54)TIV1 (56-59)AH3 (67-82)TI5 (84-87)S5 (145-150)3H1 (101-103)AH6 (161-182)TII2 (158-161)3H3 (183-185)3H2 (152-154)S6 (188-194)S7 (249-252)AH7 (200-204)AH8 (206-217)TI6 (219-222)TVIII2 (259-262)TI'1 (253-256)3H5 (256-258)3H6 (263-265)TI3 (40-43)TI4 (63-66)TI7 (242-245)3H4 (240-242)S3 (58-61)AH4 (108-111)TIV2 (245-248)Updating...
connected with : NaN
molecule tags Oxidoreductase
source organism Moraxella catarrhalis (strain bbh18)
publication title Crystal structure of Moraxella catarrhalis enoyl-ACP-reductase (FabI) in complex with the cofactor NAD
rcsb
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 95
structure length 267
sequence length 267
ec nomenclature ec 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2021-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.