7F5CA

Crystal structure of bptf-brd with ligand dc-bpi-07 bound
Total Genus 39

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
LTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TI1 (87-90)TIV1 (88-91)TI3 (91-94)EMPTYTII1 (102-105)3H1 (99-101)AH2 (105-108)AH1 (71-86)TI2 (90-93)Updating...
connected with : NaN
molecule tags Antitumor protein
source organism Homo sapiens
publication title Discovery and Optimization of Small-Molecule Inhibitors for the BPTF Bromodomains Proteins
rcsb
molecule keywords Nucleosome-remodeling factor subunit BPTF
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2021-06-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.