7F80A

Co-crystal structure of inhibitor compound ma-211 in complex with human ppardelta lbd
Total Genus 100

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
270
structure length
255
Chain Sequence
MQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGPFVIHDIETLWQAEKGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTVIII1 (190-193)AH1 (172-189)AH3 (216-224)S1 (211-213)AH2 (194-202)AH4 (241-266)Updating...
connected with : NaN
molecule tags Protein binding/inhibitor
source organism Homo sapiens
publication title Co-crystal structure of Inhibitor compound in complex with human PPARdelta LBD
rcsb
molecule keywords Peroxisome proliferator-activated receptor delta
total genus 100
structure length 255
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-06-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.