7FCOA

Chlb4 halogenase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
441
structure length
433
Chain Sequence
QPDFDAAIVGGGPAGSAMASYLAEAGLSVAVFESEMFPRPHIGESLVPATMPVLDEIGVMPDIEAAGFPKKYGAAWTSAESRDVPHNGFTGLDHDFKAAEVMFVERDQPGVHRDYTFHVDRGKFDLILLKHAESRGAQVFQKTRVLKADFDTPDLVTLLGPRTLDFTTRMVIDASGRQTMLGNQLKVKVPDPVFNQYAIHAWFEGLDRTAMALDPAKRDYIYVHFLPLEDTWMWQIPITDTITSVGVVTQKHRFKDREKFFWDIVSSRKDIYDALQKAERIRPFKAEGDYSYAMRQICGDRFLLIGDAARFVDPIFSSGVSVALNSARLAAKDVIAAHRAGDFRKESFATYEEKLRRAVRNWYEFISVYYRLNILFTAFVQDPRYRIDVLKMLQGDFYDGEEPKALKAMRDLVTKVENDPEHLWHPYLGTLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords ChlB4
publication title Crystal insight of FAD-dependent bifunctional halogenase ChlB4 in the biosynthesis of Chlorothricin
rcsb
source organism Streptomyces antibioticus
total genus 140
structure length 433
sequence length 441
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-07-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...