7FEI3

Complex of fmdv a/wh/cha/09 and bovine neutralizing scfv antibody r55
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
220
structure length
220
Chain Sequence
GIVPVACSDGYGGLVTTDPKTADPAYGMVYNPPRTNYPGRFTNLLDVAEACPTFLCFDDGKPYVVTRADEQRLLAKFDLSLAAKHMSNTYLSGIAQYYAQYSGTINLHFMFTGSTDSKARYMVAYVPPGVTTPPDTPERAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDVADTTNVQGWVCIYQITHGKAEQDTLVVSVSAGKDFELRLPIDPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of foot-and-mouth disease virus with bovine neutralizing antibodies reveal the determinant of intra-serotype cross-neutralization.
pubmed doi rcsb
molecule keywords Capsid protein VP0
molecule tags Virus
source organism Bos taurus
total genus 21
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2021-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...