7FITA

Crystal structure of wolbachia cytoplasmic incompatibility factor cida from wmel
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
418
structure length
360
Chain Sequence
TKRQAEVLKKLQDVIKHTDRDIAAGRKLAIKRWVETYIEYIKLFKDDKLEFLYNVFRDEGCWLGTRLNNTVLGQKLTEEEIDNPLPRYGMASRYCITGKIGDFDFWKKYDAVEGFDSTVKLKWSEGVEYFYNQLEEKDKEKKLTEAIVALSRPQSVKRDAPILDFCVRNIGDKDTLLQKLLQKDKGVYFLLAELIESCFFDTVHDLVQCWCYKGVSACSDKIFSQQDYELFLYSLSNVMLKNPELSVQARSLIMEIWKCERFAEYRETSVNTSNYTVPIKSVLGGLIINWKREDVCKPDREIEKEEILDMISFAKGCFPEKFDLFKEVMIENLRICGREGKRKGVDYGKFAEELFLQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitoxin
molecule keywords bacteria factor 1
publication title Crystal Structures of Wolbachia CidA and CidB Reveal Determinants of Bacteria-induced Cytoplasmic Incompatibility and Rescue.
pubmed doi rcsb
source organism Wolbachia endosymbiont of drosophila melanogaster
total genus 121
structure length 360
sequence length 418
ec nomenclature
pdb deposition date 2021-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...