7HIUA

Group deposition of chikungunya virus nsp3 macrodomain in complex with inhibitors from the readdi-ac avidd center -- crystal structure of chikungunya virus nsp3 macrodomain in complex with ra-0188492-02 (chikv_macb-x2399)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
163
structure length
162
Chain Sequence
GAMAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYTESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Group deposition of Chikungunya virus nsP3 macrodomain in complex with inhibitors from the READDI-AC AViDD center
rcsb
molecule keywords Non-structural protein 3
molecule tags Viral protein
source organism Chikungunya virus
total genus 55
structure length 162
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.-:
pdb deposition date 2024-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...