7JIEC

Structure of gii.4 p-domain in complex with noro-320 fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
235
structure length
224
Chain Sequence
QVQLVQSGPEVKKPGSSVKVSCKASGGTVSSYAISWVRQAPGQGLEWMGGIIPIFDTTNYAQKFQGRVTITADESTGTSDMELSSLRSEDTAVYYCARDRVPSYSPSAMWGKYGMDVWGQGTLVTVSSASFKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broadly cross-reactive human antibodies that inhibit genogroup I and II noroviruses
rcsb
molecule tags Viral protein
source organism Norovirus hu/gii.4/sydney/nsw0514/2012/au
molecule keywords VP1
total genus 46
structure length 224
sequence length 235
chains with identical sequence E
ec nomenclature
pdb deposition date 2020-07-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...