7JJNA

Eubacterium rectale amy13b (eur_01860)
Total Genus 190

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
YKPSAMEQMNAKNDPNVIQDNYRTCYEVFVYSFFDSDGDGIGDLKGLTEKLDYIEGLGCNEIWMMPIMPSPSYHKYDITDYMNIDKQYGTLDDFDALITECHKRNINVIIDFVINHTSNEHPWFKAAADYIKSLPDGAEPDSSECPYVDYYNFSKTNTGGYNQLPGTNWYYESQFVDSMPDLNLQSEAVRGEIDKVTSFWLDRGVDGFRLAAVIYYNNNNQTETIDDLTWLVNNVKSKKADAYMVGEGWTTYREYAKYYKSGIDSMFNFDFSQQDGYIGKVLNGAANHGASTYGNALVDVENEIKKYTDSYIDAPFYTNHDMGRSAGYYNGDNAEEKTKMAQAMNLLMPGNAFLYYGEEIGMRGTANDETKRLAMRWSGDSKAKGMCVGPQNAEETEQTYDTLDKQMEDPYSIYNFVKQTISIRNAFPEIARGTNTFEKDLSNDNVCIFTREYNGEKAVLIFNPSKDEASVDVSSLGVNDAVAMLQTTAAAPSYKDGTAKLPAYSVLVLKENLY

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
source organism [eubacterium] rectale dsm 17629
publication title The structures of the GH13_36 amylases from Eubacterium rectale and Ruminococcus bromii reveal subsite architectures that favor maltose production
doi rcsb
molecule keywords Glycosidases
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2020-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.