7JPNG

Cryo-em structure of arpin-bound arp2/3 complex
Total Genus 36

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
143
Chain Sequence
ARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
2040608010012014014012010080604020
05101520253035Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (9-12)AH2 (51-59)TIV2 (20-23)AH1 (39-48)O1 (49-51)AH7 (138-146)TI3 (63-66)AH3 (69-85)AH6 (120-135)3H2 (88-90)AH4 (91-96)AH5 (100-115)EMPTYTIV3 (33-36)TIV4 (59-62)Updating...
connected with : NaN
molecule tags Contractile protein
source organism Homo sapiens
publication title Molecular mechanism of Arp2/3 complex inhibition by Arpin.
pubmed doi rcsb
molecule keywords Actin-related protein 3
total genus 36
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2020-08-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.