7JR1A

Crystal structure of the r64f mutant of bauhinia bauhinioides kallikrein inhibitor complexed with bovine trypsin
Total Genus 54

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (165-171)EMPTYTI4 (95-98)TII3 (99-102)TII1 (16-19)TIV1 (25-28)TIV4 (48-51)S3 (40-48)S1 (20-21)TII2 (23-26)TII5 (172-175)TIV2 (34-39)TI7 (177-180)S2 (30-34)TI3 (91-94)S6 (81-90)TIV5 (60-63)S4 (51-54)S8 (134-140)3H1 (56-58)S5 (64-67)TII8 (221-224)TIV6 (66-70)TI2 (72-75)TIV7 (70-73)TIV8 (77-80)TII6 (191-194)TI5 (96-99)S7 (104-108)TVIII2 (108-111)TI6 (115-118)S10 (180-183)TII4 (130-134)TIV9 (124-128)S9 (156-162)TIV10 (192-195)TIV11 (200-203)S12 (204-215)TI8 (184-187)S11 (197-201)TIV12 (219-221)TI1 (27-30)TVIII3 (145-148)Updating...
connected with : NaN
molecule tags Hydrolase/inhibitor
source organism Bauhinia bauhinioides
publication title Structural studies of the complexes of kallikrein 4 (KLK4) with the wild-type and mutated forms of the Knitz-type inhibitor BbKI
rcsb
molecule keywords Cationic trypsin
total genus 54
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2020-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.