7JREA

Crystal structure of ev-d68 2a protease c107a mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
138
structure length
138
Chain Sequence
GFGGVFVGSFKIINYHLATIEERQSAIYVDWQSDVLVTPIAAHGRHQIARCKCNTGVYYCRHRDKSYPVCFEGPGIQWIEQNEYYPARYQTNVLLAAGPAEAGDAGGLLVCPHGVIGLLTAGGGGIVAFTDIRNLLWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, hydrolase
molecule keywords Protease 2A
publication title Crystal structure of EV-D68 2A protease C107A mutant
rcsb
source organism Human enterovirus d68
total genus 25
structure length 138
sequence length 138
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2020-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...