7JTKI

Radial spoke 1 isolated from chlamydomonas reinhardtii
Total Genus 126
50100150200250300350400450020406080100120
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
503
structure length
483
Chain Sequence
APDPVLNELYGSERPAVELLPGVPLSPIVNSCWLPADAKAMLAESWIPPAFEAAAPEYNELVRRLAKTAPFRKWNELTIQAKQLEQEVAGLKGPDAEAKQAELENVKVQIADAEAAVAEVKQSFSDDPLSLTGWMQALTDLADGGMTTFEVSGQGWPYCSLRQLFGEMPSAAPPAGFFDGVERVLGTFKRRYEKERGPGSVQLMLKLAPNVFSDAWSTGGAPAAVAAVEAYVERARANVFGPDGGVTPEGVPEPLDLVQLVWWDFAAADPLPVLKALQRMATDQLQVVSVSEPKKIRGIGLVDFPADRLKAAIQAGVPITCVQVEHSVLVRSAQPVLDLCAKYGIKVLARGGTLGGLLSAKYLGAPPPDPVRGDADLDSVPGCLDAVNNVGGWARLQAALAVIKGIADKHGVKPETVALRWQIDAGCFPLVTTRWSSRVWRQFGYEGWSSFEVSGGRPGVDGPLFQVESFLDVEDVRALAGLA
50100150200250300350400450400300200100
020406080100120Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (19-25)AH14 (428-445)S1 (32-35)S2 (38-40)TI1 (35-38)S3 (44-47)TVIII1 (41-44)AH5 (123-155)AH2 (53-58)TIV2 (49-52)AH3 (85-95)AH4 (98-120)TIV5 (205-208)TI3 (156-159)S11 (381-385)TII1 (158-161)AH6 (162-173)AH7 (208-224)EMPTYS4 (178-180)TVIa1 (184-187)TIV3 (185-188)TI4 (189-192)TI5 (190-193)TIV4 (191-194)TI8 (239-242)TI6 (192-195)AH9 (250-268)O1 (202-204)S5 (234-236)TI10 (293-296)TIV7 (294-297)TII2 (271-274)TVIII2 (270-273)TI9 (276-279)TIV8 (314-323)TVIII3 (273-276)S6 (287-290)AH10 (299-310)AH11 (341-349)S7 (313-314)TIV9 (315-324)AH13 (415-425)S8 (325-326)TIV11 (329-332)TIV19 (480-483)S9 (334-337)S10 (354-360)AH12 (369-378)TI11 (362-365)TI'2 (389-392)TIV14 (394-397)TI12 (391-394)TIV15 (395-398)TII3 (397-400)TI13 (404-407)TI14 (405-408)TIV17 (410-413)AH15 (449-460)TI'3 (470-473)TII4 (473-476)3H1 (476-478)TIV18 (471-474)S12 (465-467)AH8 (243-248)TIV10 (325-328)TIV12 (336-339)TI'1 (388-391)TIV13 (386-389)TIV16 (409-412)TIV6 (226-229)O2 (352-354)TI2 (81-84)Updating...
connected with : NaN
molecule tags Structural protein
publication title Structures of radial spokes and associated complexes important for ciliary motility.
pubmed doi rcsb
molecule keywords Flagellar radial spoke protein 1
total genus 126
structure length 483
sequence length 503
chains with identical sequence J
ec nomenclature ec 1.-.-.-:
pdb deposition date 2020-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.