7JTOK

Crystal structure of protac ms33 in complex with the wd repeat-containing protein 5 and pvhl:elonginc:elonginb
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
87
Chain Sequence
MYVKLISSDGHEFIVKREHALTSGTIKAMLSTNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A selective WDR5 degrader inhibits acute myeloid leukemia in patient-derived mouse models.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords WD repeat-containing protein 5
total genus 26
structure length 87
sequence length 96
ec nomenclature
pdb deposition date 2020-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03931 Skp1_POZ Skp1 family, tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...