7JZOA

Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycaltpp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CFTR Associated Ligand (CAL) PDZ domain bound to peptidomimetic LyCALTPP
rcsb
molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protein
molecule tags Peptide binding protein
source organism Homo sapiens
total genus 23
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...