7K3HA

Crystal structure of deep network hallucinated protein 0217
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
RGSHMSPIARQALDIAKSVLEHSKGMFDYWEGMLEQYEKTGDPDQANKLRQTLNRVKNSVGRLESALKRAERAYDTGNPDAAVGAVVELIGNVHEIMSTFHELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Network hallucinated protein 0217
publication title De novo protein design by deep network hallucination.
pubmed doi rcsb
source organism Synthetic construct
total genus 42
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...