7K5MA

Crystal structure of hbv capsid y132a mutant in complex with n-(3-chloro-4-fluorophenyl)-3-phenyl-1,4,6,7-tetrahydro-5h-pyrazolo[4,3-c]pyridine-5-carboxamide at 2.65a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
136
Chain Sequence
SMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAARPPNAPILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a new class of HBV capsid assembly modulator.
pubmed doi rcsb
molecule tags Viral protein
source organism Hepatitis b virus genotype d subtype adw (isolate united kingdom/adyw/1979)
molecule keywords Capsid protein
total genus 43
structure length 136
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00906 Hepatitis_core Hepatitis core antigen
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...