7K9RA

Cryptococcus neoformans hsp90 nucleotide binding domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
SMSTETFGFQAEISQLLDLIINTFYSNKEIFLRELISNSSDALDKIRYAALTDPSQLDSEKDLYIRIIPNKEEGTLTIRDTGIGMTKADLVNNLGTIAKSGTKAFMEALSSGADISMIGQFGVGFYSSYLVAEKVQVTTKHNDDEQYIWESAAGGTFTITEDTEGPRLGRGTSMKLFIKEDLKEYLEEKRIREIVKKHSEFISYPIQLVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fungal-Selective Resorcylate Aminopyrazole Hsp90 Inhibitors: Optimization of Whole-Cell Anticryptococcal Activity and Insights into the Structural Origins of Cryptococcal Selectivity.
pubmed doi rcsb
molecule keywords Hsp90-like protein
molecule tags Chaperone
source organism Cryptococcus neoformans
total genus 73
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2020-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...