7KBOA

Reverse transcriptase diabody with s82bc, r83t mutations crystallized in c2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
235
structure length
227
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSLSTSGIGVTWVRQAPGKGLEWLATIWWDDDNRYADSVKGRFTISADTSKNTAYLQMNCLTAEDTAVYYCAQSSAMDHWGQGTLVTVSSGGGSDIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYTSSLHSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYSKFPWTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-crystallization with diabodies: a case study for the introduction of synthetic symmetry.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Single-chain scFv
total genus 51
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2020-10-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...