7KGYA

Beta-glucuronidase from faecalibacterium prausnitzii bound to the inhibitor unc10201652-glucuronide
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
607
structure length
593
Chain Sequence
NNKSLLYPVVSTSRRVVSLDGMWRFSFDAKSEGVEANWANGLPESISMPVPASFCDFFTDKESREYCGDFWYETDFFVPGEWSGKDIAIRFGSATHHARIFVNGVEVAQHEGGFLPFDAVVTDIVRYNQFNKLSVLLNNELNEHMLPAGNTAVLSNGKKVAAPYFDFYNYAGIHRPVKLMALPTERILDYSVKHRLTAEGAEVDYTVTTNGDHEVTVELYDGTTKVAEATGKEGTLVVKDAKLWNVHAAYLYNIVIRIHDGSAVVDEYTEKVGIRTFEIKDGHFLLNGKPVYLRGFGKHEDADIRGRGLDLATVKRDYELMKWIGANCFRTSHYPYAEELYQMADEEGFLIIDEVPAVGFMESVGWFEKETTPQLLANHKDALTDMIGRDKNHASVIAWSILNEPQCTSEGTEAYFKTLFDLAHELDPQKRPRTYAVVMMSLPNNSKGQQFADFISLNRYYGWYVMGGMGIVDAEAAFRKEMNGWAQVLNGRPMIFTEYGADTMPTEHKLPSVMWSQEYQNEYLDMNHNVFDSYNFVQGELVWNFADFQTTEGILRVNGNKKGIFTRQRQPKDAAFLFRARWTSLPLDYKGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Microbial enzymes induce colitis by reactivating triclosan in the mouse gastrointestinal tract.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
source organism Faecalibacterium prausnitzii
molecule keywords Beta-glucuronidase
total genus 225
structure length 593
sequence length 607
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.23: beta-galactosidase.
pdb deposition date 2020-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...