7KJIA

Plasmodium falciparum protein pf12p bound to nanobody d9
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGIIFSSHVMGWYRQAPGKQRELVASFSGDTGAKYADSVKGRFIIRRENAKNMVTLYLQMNSLKPEDTAAYYCHVDRFGTEYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Nanobody D9
publication title Nanobody generation and structural characterization of Plasmodium falciparum 6-cysteine protein Pf12p.
pubmed doi rcsb
source organism Vicugna pacos
total genus 23
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2020-10-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...