7KMTA

Structure of the yeast trappiii-ypt1(rab1) complex
Total Genus 37
2040608010012014016005101520253035
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
174
Chain Sequence
EYDYLFKLLLIGNSGVGKSCLLLRFSDDTDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDRVVEYDVAKEFADANKMPFLETSASTNVEDAFLTMARQIKESMSQQNLVNLKGQSLT

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV4 (51-54)S1 (7-15)TI1 (16-19)S4 (83-89)O1 (19-21)S3 (55-64)TII1 (37-40)TIV1 (29-32)AH2 (70-77)S2 (43-52)TIV3 (39-42)AH5 (158-173)3H1 (67-69)AH3 (93-107)TI2 (78-81)TI4 (111-114)S5 (115-121)AH4 (133-143)S6 (147-149)TIV5 (151-156)AH1 (21-28)TI3 (107-110)Updating...
connected with : NaN
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural basis of TRAPPIII-mediated Rab1 activation.
pubmed doi rcsb
molecule keywords Trafficking protein particle complex subunit 23
total genus 37
structure length 174
sequence length 196
ec nomenclature
pdb deposition date 2020-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.