7KRPB

Structure of sars-cov-2 backtracked complex complex bound to nsp13 helicase - btc (local refinement)
Total Genus 54
2040608010012014016018001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
186
Chain Sequence
FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYAH1 (10-28)AH2 (32-97)AH3 (101-109)3H1 (117-119)S4 (184-190)O1 (180-182)3H2 (177-179)S1 (127-132)AH5 (135-142)TIV1 (148-151)S2 (146-149)S3 (152-160)TI3 (161-164)TI6 (173-176)TI4 (168-171)TI5 (169-172)TI1 (6-9)TI2 (110-113)AH4 (120-124)Updating...
connected with : NaN
molecule tags Transferase/rna
source organism Severe acute respiratory syndrome coronavirus 2
publication title Structural basis for backtracking by the SARS-CoV-2 replication-transcription complex
rcsb
molecule keywords RNA-directed RNA polymerase
total genus 54
structure length 186
sequence length 186
chains with identical sequence D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2020-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08717 CoV_NSP8 Coronavirus replicase NSP8
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.