7KZNG

Outer dynein arm core subcomplex from c. reinhardtii
Total Genus 36

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
144
structure length
138
Chain Sequence
LTDEEMDMCRKAFAMFDKDGSGTIDTKELRTALSALGQNPTEEDMFVMISQVDQDGSRCIEFKEFVRVIQINKQMSADTLDAFVALGGNLDKTGRILVDKLRSICEEFELTVNVDRLVKDADRDLNGFLSYDEFRALL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (17-30)AH3 (57-66)TI1 (31-34)AH4 (76-90)AH5 (98-104)3H1 (107-109)EMPTYTVIII1 (130-133)AH7 (135-141)AH2 (40-50)TIV1 (104-107)AH6 (118-128)TI2 (67-70)Updating...
connected with : NaN
molecule tags Motor protein
publication title Structure of a microtubule-bound axonemal dynein
doi rcsb
molecule keywords Heavy chain alpha
total genus 36
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2020-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.