7L00A

Crystal structure of c. difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
HMNKICKILNIKYPVIQGGMAWVATASLASAVSNAGGLGIIAAGNAPKEAIKKEIVECKKLTDKPFGVNVMLMSPFVDDIIDLIIEEKVQVITTGAGNPAKYMDRLKEAGTKVIPVVPTIALAQRMEKLGATAVIAEGTEGGGHIGELTTMVLVPQVADAVNIPVIAAGGIVDGRGIAASFALGASAVQVGTRFICSEECSVHSNYKNLVLKAKDRDAIVTGRSTGHPVRTLKNKLSKEFLKMEQNGATPEELDKKGTGALRFATVDGDIEKGSFMAGQSAAMVKEITPCKEIIEAMVNQAREIMPAIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of C. difficile Enoyl-Acyl Carrier Protein Reductase (FabK) in Complex with an Inhibitor
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Clostridioides difficile
molecule keywords Enoyl-Acyl Carrier Protein Reductase FabK
total genus 107
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.13.12.16: nitronate monooxygenase.
pdb deposition date 2020-12-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...