7L0LJ

Cryo-em structure of the vrc316 clinical trial, vaccine-elicited, human antibody 316-310-1b11 in complex with an h2 can05 ha trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
EIVLTQSPGTLSLSPGDRATLSCRASQSVPSSYLAWYRHKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFSLTISRVEPEDFAVYYCQQYGSSPYTFGRGTKLDIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords 316-310-1B11 Light Chain
publication title A single residue unique to influenza H2 hemagglutinin enhances the breadth of the B cell response elicited by H2 vaccination
rcsb
source organism Homo sapiens
total genus 17
structure length 108
sequence length 108
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2020-12-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...