7L31E

Cyro-em structure of human glycine receptor alpha2-beta heteromer, strychnine bound state, 3.8 angstrom
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
654
structure length
330
Chain Sequence
VPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMKRIDLYARALFPFCFLFFNVIYWSIYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the subunit composition and structure of adult human glycine receptors
doi rcsb
molecule keywords Glycine receptor subunit alpha-2
molecule tags Membrane protein
source organism Homo sapiens
total genus 66
structure length 330
sequence length 654
ec nomenclature
pdb deposition date 2020-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01353 GFP Green fluorescent protein
E PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...