7L4DA

The internal aldimine form of the wild-type salmonella typhimurium tryptophan synthase with cesium ion at the metal coordination site at 1.60 angstrom resolution
Total Genus 97

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
268
structure length
256
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (1-14)TI2 (92-95)S4 (125-128)EMPTYS1 (18-24)TII1 (24-27)S2 (48-51)AH2 (30-43)AH3 (62-74)TVIa1 (26-29)AH11 (236-243)AH4 (78-91)TI5 (244-247)O1 (171-173)TIV2 (54-57)TI1 (57-60)S3 (97-101)TI3 (128-131)AH5 (103-108)S5 (149-150)3H1 (133-135)AH7 (136-146)S6 (152-154)TI4 (155-158)AH9 (193-203)AH10 (217-226)S9 (230-233)TIV3 (233-236)S7 (174-176)AH6 (111-121)S8 (208-210)TII2 (211-214)AH12 (248-265)AH8 (160-169)Updating...
connected with : NaN
molecule tags Lyase
source organism Salmonella typhimurium (strain lt2 / sgsc1412 / atcc 700720)
publication title The internal aldimine form of the wild-type Salmonella typhimurium Tryptophan Synthase with cesium ion at the metal coordination site at 1.60 Angstrom resolution
rcsb
molecule keywords Tryptophan synthase alpha chain
total genus 97
structure length 256
sequence length 268
ec nomenclature ec 4.2.1.20: tryptophan synthase.
pdb deposition date 2020-12-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.