7L75A

Crystal structure of peptidylprolyl isomerase prsa from streptococcus mutans.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
267
structure length
267
Chain Sequence
NSKIATMKGDTITVADFYNEVKNSTASKQAVLSLLVSKVFEKQYGDKVSDKEVTKAYNEAAKYYGDSFSSALASRGYTKEDYKKQIRSEKLIEYAVKEEAKKEITDASYKSAYKDYKPEVTAQVIQLDSEDKAKSVLEEAKADGADFAKIAKDNTKGDKTEYSFDSGSTNLPSQVLSAALNLDKDGVSDVIKASDSTTYKPVYYIVKITKKTDKNADWKAYKKRLKEIIVSQKLNDSNFRNAVIGKAFKKANVKIKDKAFSEILSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Foldase protein PrsA
publication title Crystal Structure of Peptidylprolyl Isomerase PrsA from Streptococcus mutans.
rcsb
source organism Streptococcus mutans
total genus 60
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2020-12-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...