7LATA

Campylobacter jejuni keto-acid reductoisomerase in complex with mg2+
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
329
structure length
329
Chain Sequence
AITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGSVSAVKAKNAGFEVMSVSEASKIADVIMILAPDEIQADIFNVEIKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAIHQDESKNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLSALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRYSISNTAEYGDYITGPKIITEETKKAMKGVLKDIQNGVFAKDFILERRAGFARMHAERKNMNDSLIEKTGRNLRAMMPWIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ketol-acid reductoisomerase
publication title Campylobacter jejuni keto-acid reductoisomerase in complex with Mg2+
rcsb
source organism Campylobacter jejuni
total genus 126
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.86: ketol-acid reductoisomerase (NADP(+)).
pdb deposition date 2021-01-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...