7LD3B

Cryo-em structure of the human adenosine a1 receptor-gi2-protein complex bound to its endogenous agonist and an allosteric ligand
Total Genus 98

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
337
structure length
334
Chain Sequence
LDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (4-25)TI13 (212-215)AH2 (30-34)S22 (273-278)TI1 (34-37)EMPTYTI22 (298-301)S1 (47-51)TI4 (83-86)S2 (58-63)TIV1 (66-69)S26 (315-320)TI2 (64-67)S3 (69-74)TVIII1 (95-98)S5 (89-94)TI3 (74-77)S4 (78-83)TI5 (84-87)S7 (111-116)TI7 (116-119)S9 (134-140)TIV2 (115-118)S8 (120-125)S12 (165-170)S10 (146-153)TI8 (153-156)S13 (175-181)S11 (156-161)TI10 (171-174)TI11 (193-196)S14 (187-192)S15 (198-203)S17 (217-222)TI14 (213-216)S20 (250-254)TI15 (235-238)S18 (229-235)TI16 (245-248)S19 (240-245)TI18 (255-258)S24 (293-298)S23 (284-289)TI19 (266-269)S25 (304-309)TI20 (279-282)TI21 (289-292)TI23 (299-302)TI25 (331-334)TI24 (321-324)S27 (327-331)S6 (100-105)TI6 (106-109)TIV3 (125-128)TIV4 (151-154)TI9 (161-164)TIV5 (170-173)TI12 (203-206)S16 (208-212)TI17 (254-257)S21 (259-264)Updating...
connected with : NaN
molecule tags Signaling protein
source organism Homo sapiens
publication title Positive allosteric mechanisms of adenosine A 1 receptor-mediated analgesia.
pubmed doi rcsb
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-2
total genus 98
structure length 334
sequence length 337
ec nomenclature
pdb deposition date 2021-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.