7LF0E

Trimeric human arginase 1 in complex with mab2
Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
214
structure length
214
Chain Sequence
EIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQHSLLPRTFGGGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (5-6)S3 (21-24)EMPTYS9 (102-105)TVIII1 (6-9)S2 (10-12)TIV2 (25-28)TIV6 (66-69)TIV3 (29-32)S4 (33-38)TIV4 (48-51)TII1 (39-42)S6 (64-65)S7 (70-73)TI1 (79-82)S8 (85-90)TIV8 (93-96)3H1 (183-185)AH1 (122-126)S11 (129-139)S12 (147-150)S16 (191-196)S15 (173-182)S13 (153-154)TII2 (149-152)S14 (159-163)TIV11 (168-171)TIV10 (167-170)TI3 (185-188)TII3 (210-213)S17 (205-210)S5 (45-48)TI5 (198-201)S10 (114-118)Updating...
connected with : NaN
molecule tags Hydrolase/immune system
source organism Homo sapiens
publication title Cryo-EM structures of inhibitory antibodies complexed with arginase 1 provide insight into mechanism of action.
pubmed doi rcsb
molecule keywords Arginase-1
total genus 24
structure length 214
sequence length 214
chains with identical sequence H, I, L, O, P
ec nomenclature
pdb deposition date 2021-01-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.