7LHYA

Caenorhabditis elegans swsn-4 (smarca4-brg1) atpase bromodomain in complex with a modified histone h3, n6-epsilon-acetyl-l-lysine 14 (h3k14ac) polypeptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
DPELAEKINEMLDVILEYKNEDGELIADVFQTLPTRKELPDYYQVISKPMDFDRINKKIETGRYTVMEELNDDMNLLVNNAQTYNEEGSEIYVSSETIGKLWKEQYDKFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding specificity and function of the SWI/SNF subunit SMARCA4 bromodomain interaction with acetylated histone H3K14.
pubmed doi rcsb
molecule keywords SWI/SNF nucleosome remodeling complex component
molecule tags Peptide binding protein
source organism Caenorhabditis elegans
total genus 38
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2021-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...