7LIHA

Cryoem structure of mayaro virus icosahedral subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
160
structure length
160
Chain Sequence
RERMCMKIEHDCIFEVKHEGKVTGYACLVGDKVMKPAHVPGVIDNADLARLSYKKSSKYDLECAQIPVAMKSDASKYTHEKPEGHYNWHYGAVQYTGGRFTVPTGVGKPGDSGRPIFDNKGPVVAIVLGGANEGTRTALSVVTWNKDMVTKITPEGTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution Cryo-EM structure of Mayaro virus identifies key structural determinants of alphavirus particle formation
rcsb
molecule keywords Capsid protein
molecule tags Viral protein
total genus 18
structure length 160
sequence length 160
chains with identical sequence B, C, F
ec nomenclature ec 3.4.21.90: togavirin.
pdb deposition date 2021-01-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...