7LLDA

Crystal structure of genb4 in complex with external aldimine of plp-sisomicin
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
446
structure length
446
Chain Sequence
HMNYRELIERARRTTAAEEYDISGRYPSVIAHAEGAWMTDLSGNRYVDLTGADAAVILGYRHPAVNEAITRQIRDYGTTFASTLSVPRVELAERMCERYECAEKVVFHKTGTEGTAMAVRLARAATGRELVLSSGYHGWHEWQMAGEEFGYQQSTGVVGFGYNEKALAKMLEAFGEQVAGVIVSPEVLYFDLDHYRRMSALCARYDVPFMLDEVYTGFRAGPKGVHGLGVPADVVVLGKGLANGHSLAAVMGRRDIIDAYDVSGIQGTYTREVPPMAAALAVFEVLDTPGVYEHAEAMGRRLADGMREILTGEGIPNWVGGPALMFDVVLPNDDLGWEIYKTAHDFGVYFEDSGTQLVTAAFDEAAVDHALTAFRKATRQVVADRPDIAPTSGGELTEERKLDFAEEAFGGLLRDDERTNALIDETIEKVVNRDRSIKPVLFPAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords C-6' aminotransferase
publication title Crystal structure of GenB4 in complex with external aldimine of PLP-sisomicin
rcsb
source organism Micromonospora echinospora
total genus 166
structure length 446
sequence length 446
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...