7LNNA

E. coli s-adenosyl methionine transferase co-crystallized with guanosine-5'-imidotriphosphate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
375
Chain Sequence
KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
publication title Protein and substrate flexibility contribute to enzymatic specificity in human and bacterial methionine adenosyltransferases
rcsb
source organism Escherichia coli 908573
total genus 126
structure length 375
sequence length 381
chains with identical sequence B
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2021-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...