7LR4A

Complex of fab 2/1.12 with domain 3 of p. berghei hap2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
216
Chain Sequence
FQLLQSGPELVKPGASVKISCKASDYSLSDYNMNWVRQRSGKSLEWIGVINPNHGTTHYNQKFKGKATLTVDQSSSTAYMQLTSLTSEDSAVYYCASPIHYGNHVPFDYWGQGTTVTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of malaria transmission blockade by a monoclonal antibody to gamete fusogen HAP2.
pubmed doi rcsb
molecule keywords D3_2/1.12 Fab heavy chain
molecule tags Cell adhesion/immune system
source organism Mus musculus
total genus 43
structure length 216
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2021-02-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...