7LS1j

80s ribosome from mouse bound to eef2 (class ii)
Total Genus 42
204060801001201401601800510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
DRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (6-23)S2 (51-54)S11 (188-194)S1 (26-31)TIV3 (80-83)EMPTYTI6 (78-81)TIV1 (32-35)AH4 (97-105)AH2 (37-47)S3 (86-91)TI1 (47-50)AH3 (58-68)TI4 (72-75)TI3 (68-71)TVIII1 (70-73)TIV2 (69-72)3H1 (76-78)TIV4 (94-97)AH6 (169-178)S4 (115-117)S8 (151-154)S5 (121-123)TIV6 (147-150)S7 (145-148)S6 (127-128)TI8 (131-134)AH5 (135-141)S9 (158-161)S10 (165-167)TIV7 (162-165)TIV8 (193-196)TIV5 (112-115)Updating...
connected with : NaN
molecule tags Ribosome
publication title Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance
rcsb
molecule keywords 60S ribosomal protein L7
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2021-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00428 Ribosomal_60s 60s Acidic ribosomal protein
j PF00466 Ribosomal_L10 Ribosomal protein L10
j PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.