7LSVA

Non-kinase domain of legionella effector protein kinase legk2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
157
structure length
157
Chain Sequence
KNQMSKQQLLGEIQGFKENYWNMKDLLTLTNRHHLRVFLEYLDNICSAFKDDKTDEKSARAAYDFLNAQINKLFEDNSKNSKPSFESFSEDVQRFLIHIDTYLMKNPSACSNSIASTIQLLKQLDNKKSFNPEQSFKDFCSYKEITIQLLLKPFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Non-kinase domain of Legionella effector protein kinase LegK2
rcsb
molecule tags Protein binding
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 / dsm 7513)
molecule keywords Calmodulin-dependent protein kinase
total genus 72
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.11.17: calcium/calmodulin-dependent protein kinase.
pdb deposition date 2021-02-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...