The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
269
|
structure length |
238
|
Chain Sequence |
DKYKDWHFISKNCHYEQLMDLEMKDTAYSFLEFVHLKCPSITNLLVLFGVNQEKLKINYEKKENSRYDNLCTIFPVNKMLKFLMYFYSDDDNDDVREFFLKAFICLILDRKVFNAMESDHRLCFKVLELFNEAHFINSYFEIVDKNDFFLHYRLLQIFPHLQSALLRRRFSTIQQNIIKEFNEFFDCKNYKNLLYFILTMYGSKFIPFGPKEYFKDCILDISVEISILKGILNLFSKI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Integrative analysis reveals unique structural and functional features of the Smc5/6 complex.
pubmed doi rcsb |
| molecule tags |
Structural protein
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
Non-structural maintenance of chromosome element 5
|
| total genus |
50
|
| structure length |
238
|
| sequence length |
269
|
| ec nomenclature | |
| pdb deposition date | 2021-02-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF08691 | Nse5 | DNA repair proteins Nse5 and Nse6 |
| B | PF00240 | ubiquitin | Ubiquitin family |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
