7LUWA

Structural studies about scntx neurotoxin using solution nmr 2d and 3d
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
MRGSHHHHHHGSIEGRMICYNQQSSQPPTTKTCSETSCYKKTWRDHRGTIIERGCGCPKVKPGIKLHCCRTDKCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-Dimensional Structure of the Neurotoxin SCNTX
rcsb
molecule keywords Short-chain neurotoxin
molecule tags Neuropeptide
source organism Synthetic construct
total genus 10
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2021-02-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...