7LV8C

Structure of the marseillevirus nucleosome
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
ESKEGSRSSKAKLQISVARSERLLREHGGCSRVSEGAAVALAAAIEYFMGEVLELAGNAARDSKKVRISVKHITLAIQNDAALFAVVGKGVFSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a virus-encoded nucleosome
doi rcsb
molecule keywords Histone doublet Delta-Gamma (Delta)
molecule tags Structural protein/dna
source organism Marseillevirus marseillevirus
total genus 21
structure length 94
sequence length 94
chains with identical sequence G
ec nomenclature
pdb deposition date 2021-02-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...