7LVSB

The cbp taz1 domain in complex with a cited2-hif-1-alpha fusion peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
TGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The molecular basis of allostery in a facilitated dissociation process.
pubmed doi rcsb
molecule keywords Histone lysine acetyltransferase CREBBP
molecule tags Transcription
source organism Mus musculus
total genus 31
structure length 97
sequence length 97
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2021-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02135 zf-TAZ TAZ zinc finger
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...